PDB entry 6hgq

View 6hgq on RCSB PDB site
Description: Crystal Structure of Human APRT wild type in complex with Hypoxanthine, PRPP and Mg2+
Class: transferase
Keywords: Rossman fold, transferase
Deposited on 2018-08-23, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgqa_
  • Chain 'B':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgqb_
  • Chain 'C':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgqc_
  • Chain 'D':
    Compound: Adenine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: APRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hgqd_
  • Heterogens: HPA, MG, PRP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hgqA (A:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hgqB (B:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgqB (B:)
    selqlveqrirsfpdfpvvfrdispvlkdpasfraaigllarhlkathggridyiaglds
    rgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqrvvvv
    ddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hgqC (C:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hgqD (D:)
    adselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyi
    agldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgq
    rvvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hgqD (D:)
    selqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyiag
    ldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqrv
    vvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye