PDB entry 6hge

View 6hge on RCSB PDB site
Description: crystal structure of alpha1-antichymotrypsin variant newbg-i in the uncleaved s-conformation
Deposited on 2018-08-23, released 2019-05-29
The last revision was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antichymotrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA3, AACT, GIG24, GIG25
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01011
      • engineered mutation (32)
      • engineered mutation (250)
      • engineered mutation (252)
      • engineered mutation (277-278)
      • engineered mutation (282)
      • engineered mutation (285)
      • engineered mutation (390-392)
      • engineered mutation (394-395)
  • Chain 'B':
    Compound: alpha-1-antichymotrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA3, AACT, GIG24, GIG25
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01011
      • engineered mutation (32)
      • engineered mutation (250)
      • engineered mutation (252)
      • engineered mutation (277-278)
      • engineered mutation (282)
      • engineered mutation (285)
      • engineered mutation (390-392)
      • engineered mutation (394-395)
  • Chain 'C':
    Compound: alpha-1-antichymotrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA3, AACT, GIG24, GIG25
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01011
      • engineered mutation (32)
      • engineered mutation (250)
      • engineered mutation (252)
      • engineered mutation (277-278)
      • engineered mutation (282)
      • engineered mutation (285)
      • engineered mutation (390-392)
      • engineered mutation (394-395)
  • Chain 'D':
    Compound: alpha-1-antichymotrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA3, AACT, GIG24, GIG25
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01011
      • engineered mutation (32)
      • engineered mutation (250)
      • engineered mutation (252)
      • engineered mutation (277-278)
      • engineered mutation (282)
      • engineered mutation (285)
      • engineered mutation (390-392)
      • engineered mutation (394-395)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hgeA (A:)
    mkhhhhhhmkqnspldeenltqenqdrgthvdrglasanvdfafslykqlvlkapdknvi
    fsplsistalaflslgahnttlteilkglkfnltetseaeihqsfqhllrtlnqssdelq
    lsmgnamfvkeqlslldrftedakrlygseafatdfqdsaaakklindyvkngtrgkitd
    likdldsqtmmvlvnyiffkakwempfdpqdthqsrfylskkkwvmvpmmslhhltipyf
    rdeelsctvvqlnytgnasalfilpdqdkmeeveamlsretlnrwgdslefreigelylp
    kfsisrdynlndillqlgieeaftskadlsgitgarnlavsqvvhkavldvfeegteasa
    atavkitllsalvetrtivrfnrpflmiivdhftwsiffmskvtnpkqa
    

    Sequence, based on observed residues (ATOM records):
    >6hgeA (A:)
    vdrglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglk
    fnltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygse
    afatdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpq
    dthqsrfylskkkwvmvpmmslhhltipyfrdeelsctvvqlnytgnasalfilpdqdkm
    eeveamlsretlnrwgdslefreigelylpkfsisrdynlndillqlgieeaftskadls
    gitgarnlavsqvvhkavldvfeegteasartivrfnrpflmiivdhftwsiffmskvtn
    pkq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hgeB (B:)
    mkhhhhhhmkqnspldeenltqenqdrgthvdrglasanvdfafslykqlvlkapdknvi
    fsplsistalaflslgahnttlteilkglkfnltetseaeihqsfqhllrtlnqssdelq
    lsmgnamfvkeqlslldrftedakrlygseafatdfqdsaaakklindyvkngtrgkitd
    likdldsqtmmvlvnyiffkakwempfdpqdthqsrfylskkkwvmvpmmslhhltipyf
    rdeelsctvvqlnytgnasalfilpdqdkmeeveamlsretlnrwgdslefreigelylp
    kfsisrdynlndillqlgieeaftskadlsgitgarnlavsqvvhkavldvfeegteasa
    atavkitllsalvetrtivrfnrpflmiivdhftwsiffmskvtnpkqa
    

    Sequence, based on observed residues (ATOM records):
    >6hgeB (B:)
    hvdrglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkgl
    kfnltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygs
    eafatdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdp
    qdthqsrfylskkkwvmvpmmslhhltipyfrdeelsctvvqlnytgnasalfilpdqdk
    meeveamlsretlnrwgdslefreigelylpkfsisrdynlndillqlgieeaftskadl
    sgitgarnlavsqvvhkavldvfeegteastrtivrfnrpflmiivdhftwsiffmskvt
    npkq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6hgeC (C:)
    mkhhhhhhmkqnspldeenltqenqdrgthvdrglasanvdfafslykqlvlkapdknvi
    fsplsistalaflslgahnttlteilkglkfnltetseaeihqsfqhllrtlnqssdelq
    lsmgnamfvkeqlslldrftedakrlygseafatdfqdsaaakklindyvkngtrgkitd
    likdldsqtmmvlvnyiffkakwempfdpqdthqsrfylskkkwvmvpmmslhhltipyf
    rdeelsctvvqlnytgnasalfilpdqdkmeeveamlsretlnrwgdslefreigelylp
    kfsisrdynlndillqlgieeaftskadlsgitgarnlavsqvvhkavldvfeegteasa
    atavkitllsalvetrtivrfnrpflmiivdhftwsiffmskvtnpkqa
    

    Sequence, based on observed residues (ATOM records):
    >6hgeC (C:)
    drglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkf
    nltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygsea
    fatdfqdsaaakklindyvkngtldsqtmmvlvnyiffkakwempfdpqdthqsrfylsk
    kkwvmvpmmslhhltipyfrdeelsctvvqlnytgnasalfilpdqdkmeeveamlsret
    lnrwgdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgarnlavs
    qvvhkavldvfeegteartivrfnrpflmiivdhftwsiffmskvtnpkq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6hgeD (D:)
    mkhhhhhhmkqnspldeenltqenqdrgthvdrglasanvdfafslykqlvlkapdknvi
    fsplsistalaflslgahnttlteilkglkfnltetseaeihqsfqhllrtlnqssdelq
    lsmgnamfvkeqlslldrftedakrlygseafatdfqdsaaakklindyvkngtrgkitd
    likdldsqtmmvlvnyiffkakwempfdpqdthqsrfylskkkwvmvpmmslhhltipyf
    rdeelsctvvqlnytgnasalfilpdqdkmeeveamlsretlnrwgdslefreigelylp
    kfsisrdynlndillqlgieeaftskadlsgitgarnlavsqvvhkavldvfeegteasa
    atavkitllsalvetrtivrfnrpflmiivdhftwsiffmskvtnpkqa
    

    Sequence, based on observed residues (ATOM records):
    >6hgeD (D:)
    rglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfn
    ltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseaf
    atdfqdsaaakklindyvkngtdsqtmmvlvnyiffkakwempfdpqdthqsrfylskkk
    wvmvpmmslhhltipyfrdeelsctvvqlnytgnasalfilpdqdkmeeveamlsretln
    rwgdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitgarnlavsqv
    vhkavldvfeegteastivrfnrpflmiivdhftwsiffmskvtnpkq