PDB entry 6hga

View 6hga on RCSB PDB site
Description: Crystal Structure of the human IL-17RC D2-D3-D4 domains in complex with an anti-APP tag Fab
Class: immune system
Keywords: FnIII domains, Fab complex, IMMUNE SYSTEM
Deposited on 2018-08-23, released 2020-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Interleukin-17 receptor C
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17RC, UNQ6118/PRO20040/PRO38901
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NAC3 (Start-259)
      • engineered mutation (55)
      • variant (99)
      • engineered mutation (141)
      • engineered mutation (164)
      • engineered mutation (198)
      • expression tag (260-263)
  • Chain 'H':
    Compound: anti-APP-tag Fab heavy-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HGA (0-221)
  • Chain 'L':
    Compound: anti-APP-tag Fab light-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HGA (0-218)
    Domains in SCOPe 2.07: d6hgal1, d6hgal2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hgaL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqnthvpltfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec