PDB entry 6hg4

View 6hg4 on RCSB PDB site
Description: crystal structure of the human il-17rc ecd in complex with human il- 17f
Deposited on 2018-08-22, released 2020-03-18
The last revision was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 3.32 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-17F
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17F
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interleukin-17 receptor C
    Species: Homo sapiens [TaxId:9606]
    Gene: IL17RC, UNQ6118/PRO20040/PRO38901
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NAC3 (0-End)
      • engineered mutation (165)
      • engineered mutation (205)
      • engineered mutation (232)
      • engineered mutation (242)
      • engineered mutation (286)
      • engineered mutation (328)
      • engineered mutation (351)
      • engineered mutation (385)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hg4A (A:)
    efrhdsrkipkvghtffqkpescppvpggsmkldigiinenqrvsmsrniesrstspwny
    tvtwdpnrypsevvqaqcrnlgcinaqgkedismnsvpiqqetlvvrrkhqgcsvsfqle
    kvlvtvgctcvtpvihhvq
    

    Sequence, based on observed residues (ATOM records):
    >6hg4A (A:)
    smkldigiinenqrvsmsrniesrstspwnytvtwdpnrypsevvqaqcrnlgcinaqgk
    edismnsvpiqqetlvvrrkhvsfqlekvlvtvgctcvtpvihh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hg4B (B:)
    lerlvgpqdathcspglscrlwdsdilclpgdivpapgpvlapthlqtelvlrcqketdc
    dlclrvavhlavhghweepedeekfggaadsgveeprnaslqaqvvlsfqayptarcvll
    evqvpaalvqfgqsvgsvvydcfeaalgsevriwsytqpryekelqhtqqlpdcrglevw
    nsipscwalpwlnvsadgdnvhlvlqvseeqhfglslywnqvqgppkprwhkqltgpqii
    tlqhtdlvpclciqvwplepdsvrtnicpfredprahqnlwqaarlrlltlqswlldapc
    slpaeaalcwrapggdpcqplvpplsweqvtvdkvlefpllkghpnlcvqvqsseklqlq
    eclwadslgplkddvllletrgpqdqrslcalepsgctslpskastraarlgeyllqdlq
    sgqclqlwdddlgalwacpmdkyihkrefrh
    

    Sequence, based on observed residues (ATOM records):
    >6hg4B (B:)
    lerlvgpqdathcspglscrlwdsdilclpgdivpapgpvlapthlqtelvlrcqketdc
    dlclrvavhlavhghweernaslqaqvvlsfqayptarcvllevqvpaalvqfgqsvgsv
    vydcfeaalgsevriwsytqpryekelqhtqqlpdcrglevwnsipscwalpwlnvsadg
    dnvhlvlqvseeqhfglslywnqvqgppkprwhkqltgpqiitlqhtdlvpclciqvwpl
    epdsvrtnicpfredprahqnlwqaarlrlltlqswlldapcslpaeaalcwrapggdpc
    qplvpplsweqvtvdkvlefpllkghpnlcvqvqsseklqlqeclwadslgplkddvlll
    etrgpqdqrslcalepsgctslpskastraarlgeyllqdlqsgqclqlwdddlgalwac
    pmdkyih