PDB entry 6hg0

View 6hg0 on RCSB PDB site
Description: Influenza A Virus N9 Neuraminidase complex with NANA (Tern/Australia).
Class: hydrolase
Keywords: Complex, NANA, N-Acetylneuraminic acid, Neuraminidase, N9, Influenza, Virus, Hydrolase, Enzyme, Inhibitor, Tern
Deposited on 2018-08-22, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) [TaxId:384509]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hg0a_
  • Heterogens: NAG, BMA, MAN, CA, GOL, PO4, SIA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hg0A (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl