PDB entry 6hfx

View 6hfx on RCSB PDB site
Description: crystal structure of extracellular domain 1 (ecd1) of ftsx from s. pneumonie in complex with n-decyl-b-d-maltoside
Deposited on 2018-08-22, released 2019-04-24
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein FtsX
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ERS044004_00806
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cell division protein FtsX
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ERS044004_00806
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DMU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hfxA (A:)
tdiennvrvvvyirkdvednsqtiekegqtvtnndyhkvydslknmstvksvtfsskeeq
yeklteimgdnwkifegdanplydayiveanapndvktiaedakkiegvsevqd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6hfxB (B:)
tdiennvrvvvyirkdvednsqtiekegqtvtnndyhkvydslknmstvksvtfsskeeq
yeklteimgdnwkifegdanplydayiveanapndvktiaedakkiegvsevqd