PDB entry 6hfg

View 6hfg on RCSB PDB site
Description: structure of the rec114 ph domain
Deposited on 2018-08-21, released 2019-07-03
The last revision was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Meiotic recombination protein REC114
    Species: Mus musculus [TaxId:10090]
    Gene: Rec114
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CWH4 (2-End)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hfgB (B:)
amgevsqwslkrygrfmlldnvgspgpsseaaaagsptwkvfesseesgslvltivvsgh
ffisqgqtllegfsligsknwlkivrrmdcllfgttiknksrmfrvqfsgeskeealerc
cgcvqtlaqyvtvqepdsttqelqqsq

    Sequence, based on observed residues (ATOM records):
    >6hfgB (B:)
amgevsqwslkrygrfmlgsptwkvfesseesgslvltivvsghffisqgqtllegfsli
gsknwlkivrrmdcllfgtmfrvqfsgeskeealerccgcvqtlaqyvtvqepd