PDB entry 6hf6

View 6hf6 on RCSB PDB site
Description: Crystal structure of the Protease 1 (E29A,E60A,E80A) from Pyrococcus horikoshii co-crystallized with Tb-Xo4.
Class: hydrolase
Keywords: meshandcollect, de novo phasing, SAD, crystallization, Tb-Xo4, crystallophore, Lanthanide complex, multi-crystals data collection, ccCluster, HYDROLASE
Deposited on 2018-08-21, released 2019-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413 (0-165)
      • engineered mutation (28)
      • engineered mutation (59)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d6hf6a_
  • Chain 'B':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413 (0-165)
      • engineered mutation (28)
      • engineered mutation (59)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d6hf6b_
  • Chain 'C':
    Compound: Deglycase PH1704
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413 (0-165)
      • engineered mutation (28)
      • engineered mutation (59)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d6hf6c_
  • Heterogens: 7MT, MLI, TB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hf6A (A:)
mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hf6B (B:)
mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hf6C (C:)
mkvlfltanefedveliypyhrlkeeghavyiasfergtitgkhgysvkvdltfdkvnpa
efdalvlpggrapervrlnakavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk