PDB entry 6hf5

View 6hf5 on RCSB PDB site
Description: Crystal Structure of the Acquired VIM-2 Metallo-beta-Lactamase in Complex with ANT-431 Inhibitor
Class: hydrolase
Keywords: metallo-beta-lactamase fold, zinc-dependent hydrolase, PFam00753, alpha-beta-beta-alpha sandwich, hydrolase
Deposited on 2018-08-21, released 2018-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactamase class b vim-2
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, VIM-2, vim-2, DI492_33875
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K2N0 (0-230)
  Domains in SCOPe 2.08: d6hf5a_
• Heterogens: G1N, ZN, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6hf5A (A:)
  eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
  taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
  thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
  adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr