PDB entry 6hf2

View 6hf2 on RCSB PDB site
Description: the structure of boman26b, a gh26 beta-mannanase from bacteroides ovatus
Deposited on 2018-08-21, released 2019-04-24
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycosyl hydrolase family 26
    Species: Bacteroides ovatus ATCC 8483 [TaxId:411476]
    Gene: BACOVA_02093
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7LW89 (Start-359)
      • expression tag (360)
  • Heterogens: CL, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hf2A (A:)
    mkniynfliyfifcgigagcssssgedfpapesepvdnslikkelctegasveakkvyty
    lrncwgrktlsstmanvtwnvneaiwvnrqtgkypaiacfdymnlpaspadwidynkisv
    vedwwnagglvaacwhwnvpvtensseykcmisetdfditkalqegtreneiikadleel
    agyllllkqknipviwrplheaagkwfwwgkdaasykrlwklvyetfkqkglnnliwvwt
    setndrdwypgdayvdiigrdvyhktsaaglatdfdalkkafpdklialsecgdvatidk
    qlaagaqwawfmtwydyevtkdttapvfnsgqhehadkawwnnafgqpgvicrsdlpsfk
    lehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6hf2A (A:)
    dnslikkelctegasveakkvytylrncwgrktlsstmanvtwnvneaiwvnrqtgkypa
    iacfdymnlpaspadwidynkisvvedwwnagglvaacwhwnvpvtensseykcmisetd
    fditkalqegtreneiikadleelagyllllkqknipviwrplheaagkwfwwgkdaasy
    krlwklvyetfkqkglnnliwvwtsetndrdwypgdayvdiigrdvyhktsaaglatdfd
    alkkafpdklialsecgdvatidkqlaagaqwawfmtwydyevtkdttapvfnsgqheha
    dkawwnnafgqpgvicrsdlpsfkl