PDB entry 6hey

View 6hey on RCSB PDB site
Description: Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712 derivative ATNK002
Class: transferase
Keywords: Inhibitor, Complex, Protein Tyrosine Kinase, Transferase
Deposited on 2018-08-20, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6heya_
  • Heterogens: FZW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6heyA (A:)
    gdpnqavlkftteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagyte
    kqrvdflgeagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvl
    qlvgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatytt
    sggkipirwtapeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgf
    rlptpmdcpsaiyqlmmqcwqqerarrpkfadivsildklirapdslktladfdprvsir
    lpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6heyA (A:)
    avlkftteihpscvtrqkvigagefgevykgmlktsevpvaiktlkagytekqrvdflge
    agimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgi
    aagmkylanmnyvhrdlaarnilvnsnlvckvsdfglskipirwtapeaisyrkftsasd
    vwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqera
    rrpkfadivsildklirapdslktladfdprvsirlp