PDB entry 6her

View 6her on RCSB PDB site
Description: Mouse prion protein in complex with Nanobody 484
Class: protein binding
Keywords: Prion, Nanobody, aggregation, B-sheet, PROTEIN BINDING
Deposited on 2018-08-20, released 2019-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, Prn-p, Prp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hera_
  • Chain 'B':
    Compound: Nanobody 484
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HER (0-123)
    Domains in SCOPe 2.07: d6herb1, d6herb2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6herA (A:)
    agavvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvh
    dcvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6herA (A:)
    agavvgglggymgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
    cvnitikqhtvtnftetdvkmmervveqmcvtqyqkesqayyd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6herB (B:)
    qvqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
    tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
    tvss