PDB entry 6hee

View 6hee on RCSB PDB site
Description: crystal structure of extracellular domain 1 (ecd1) of ftsx from s. pneumonie in complex with undecyl-maltoside
Deposited on 2018-08-20, released 2019-04-24
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein FtsX
    Species: Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) [TaxId:373153]
    Gene: ftsX, SPD_0660
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cell division protein FtsX
    Species: Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) [TaxId:373153]
    Gene: ftsX, SPD_0660
    Database cross-references and differences (RAF-indexed):
  • Heterogens: UMQ, SO4, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6heeA (A:)
klatdiennvrvvvyirkdvednsqtiekegqtvtnndyhkvydslknmstvksvtfssk
eeqyeklteimgdnwkifegdanplydayiveanapndvktiaedakkiegvsevqd

    Sequence, based on observed residues (ATOM records):
    >6heeA (A:)
latdiennvrvvvyirkdvednsqtiekegqtvtnndyhkvydslknmstvksvtfsske
eqyeklteimgdnwkifegdanplydayiveanapndvktiaedakkiegvsevqd

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6heeB (B:)
klatdiennvrvvvyirkdvednsqtiekegqtvtnndyhkvydslknmstvksvtfssk
eeqyeklteimgdnwkifegdanplydayiveanapndvktiaedakkiegvsevqd

    Sequence, based on observed residues (ATOM records):
    >6heeB (B:)
iennvrvvvyirkdvednsqtiekegqtvdyhkvydslknvtfsskeeqyeklteimgdn
wkifegdanplydayivapndvktiaedakkiegvsevqd