PDB entry 6he8

View 6he8 on RCSB PDB site
Description: pan-proteasome in state 1
Deposited on 2018-08-20, released 2018-12-26
The last revision was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: EM
Resolution: 6.86 Å
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain '2':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain '3':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain '4':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain '5':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain '7':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Proteasome-activating nucleotidase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: pan, AF_1976
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Proteasome-activating nucleotidase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: pan, AF_1976
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Proteasome-activating nucleotidase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: pan, AF_1976
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Proteasome-activating nucleotidase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: pan, AF_1976
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Proteasome-activating nucleotidase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: pan, AF_1976
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Proteasome-activating nucleotidase
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: pan, AF_1976
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Proteasome subunit alpha
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmA, AF_0490
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Proteasome subunit beta
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: psmB, AF_0481
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, MG, ADP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records:
    >6he81 (1:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records:
    >6he82 (2:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records:
    >6he83 (3:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records:
    >6he84 (4:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records:
    >6he85 (5:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records:
    >6he86 (6:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records:
    >6he87 (7:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6he8A (A:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6he8B (B:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6he8C (C:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6he8D (D:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6he8E (E:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >6he8F (F:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6he8G (G:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >6he8H (H:)
    lleklkkleedyyklrelyrrledekkfieseriryerevrrlrseverlrsppllvgvv
    sdiledgrvvvksstgpkfvvntsqyineeelkpgarvalnqqtlaivnvlptskdpmvy
    gfeveekpevsyediggldvqieeireavelpllkpelfaevgieppkgvllygppgtgk
    tllakavanqtratfirvvgsefvqkyigegarlvrevfqlakekapsiifideldaiaa
    rrtnsdtsgdrevqrtmmqllaeldgfdprgdvkvigatnridildpailrpgrfdriie
    vplptfegriqifkihtrkmklaedvdfkelaritegasgadikaicteagmfaireera
    kvtmldftkaiekvlkkttpipdlkgvmfv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >6he8I (I:)
    lleklkkleedyyklrelyrrledekkfieseriryerevrrlrseverlrsppllvgvv
    sdiledgrvvvksstgpkfvvntsqyineeelkpgarvalnqqtlaivnvlptskdpmvy
    gfeveekpevsyediggldvqieeireavelpllkpelfaevgieppkgvllygppgtgk
    tllakavanqtratfirvvgsefvqkyigegarlvrevfqlakekapsiifideldaiaa
    rrtnsdtsgdrevqrtmmqllaeldgfdprgdvkvigatnridildpailrpgrfdriie
    vplptfegriqifkihtrkmklaedvdfkelaritegasgadikaicteagmfaireera
    kvtmldftkaiekvlkkttpipdlkgvmfv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >6he8J (J:)
    lleklkkleedyyklrelyrrledekkfieseriryerevrrlrseverlrsppllvgvv
    sdiledgrvvvksstgpkfvvntsqyineeelkpgarvalnqqtlaivnvlptskdpmvy
    gfeveekpevsyediggldvqieeireavelpllkpelfaevgieppkgvllygppgtgk
    tllakavanqtratfirvvgsefvqkyigegarlvrevfqlakekapsiifideldaiaa
    rrtnsdtsgdrevqrtmmqllaeldgfdprgdvkvigatnridildpailrpgrfdriie
    vplptfegriqifkihtrkmklaedvdfkelaritegasgadikaicteagmfaireera
    kvtmldftkaiekvlkkttpipdlkgvmfv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >6he8K (K:)
    lleklkkleedyyklrelyrrledekkfieseriryerevrrlrseverlrsppllvgvv
    sdiledgrvvvksstgpkfvvntsqyineeelkpgarvalnqqtlaivnvlptskdpmvy
    gfeveekpevsyediggldvqieeireavelpllkpelfaevgieppkgvllygppgtgk
    tllakavanqtratfirvvgsefvqkyigegarlvrevfqlakekapsiifideldaiaa
    rrtnsdtsgdrevqrtmmqllaeldgfdprgdvkvigatnridildpailrpgrfdriie
    vplptfegriqifkihtrkmklaedvdfkelaritegasgadikaicteagmfaireera
    kvtmldftkaiekvlkkttpipdlkgvmfv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >6he8L (L:)
    lleklkkleedyyklrelyrrledekkfieseriryerevrrlrseverlrsppllvgvv
    sdiledgrvvvksstgpkfvvntsqyineeelkpgarvalnqqtlaivnvlptskdpmvy
    gfeveekpevsyediggldvqieeireavelpllkpelfaevgieppkgvllygppgtgk
    tllakavanqtratfirvvgsefvqkyigegarlvrevfqlakekapsiifideldaiaa
    rrtnsdtsgdrevqrtmmqllaeldgfdprgdvkvigatnridildpailrpgrfdriie
    vplptfegriqifkihtrkmklaedvdfkelaritegasgadikaicteagmfaireera
    kvtmldftkaiekvlkkttpipdlkgvmfv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >6he8M (M:)
    lleklkkleedyyklrelyrrledekkfieseriryerevrrlrseverlrsppllvgvv
    sdiledgrvvvksstgpkfvvntsqyineeelkpgarvalnqqtlaivnvlptskdpmvy
    gfeveekpevsyediggldvqieeireavelpllkpelfaevgieppkgvllygppgtgk
    tllakavanqtratfirvvgsefvqkyigegarlvrevfqlakekapsiifideldaiaa
    rrtnsdtsgdrevqrtmmqllaeldgfdprgdvkvigatnridildpailrpgrfdriie
    vplptfegriqifkihtrkmklaedvdfkelaritegasgadikaicteagmfaireera
    kvtmldftkaiekvlkkttpipdlkgvmfv
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >6he8a (a:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

    Sequence, based on observed residues (ATOM records):
    >6he8a (a:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >6he8b (b:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

    Sequence, based on observed residues (ATOM records):
    >6he8b (b:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >6he8c (c:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

    Sequence, based on observed residues (ATOM records):
    >6he8c (c:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >6he8d (d:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

    Sequence, based on observed residues (ATOM records):
    >6he8d (d:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >6he8e (e:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

    Sequence, based on observed residues (ATOM records):
    >6he8e (e:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >6he8f (f:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

    Sequence, based on observed residues (ATOM records):
    >6he8f (f:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >6he8g (g:)
    qmgydraitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadti
    ekiykidehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqyt
    qyggvrpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddls
    fddamvlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirell
    kk
    

    Sequence, based on observed residues (ATOM records):
    >6he8g (g:)
    raitvfspdgrlfqveyareavkrgataigikckegviliadkrvgsklleadtiekiyk
    idehicaatsglvadarvlidrarieaqinrltydepitvkelakkicdfkqqytqyggv
    rpfgvslliagvdevpklyetdpsgalleykataigmgrnavteffekeyrddlsfddam
    vlglvamglsieselvpenievgyvkvddrtfkevspeelkpyveranerirellkk
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records:
    >6he8h (h:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records:
    >6he8i (i:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records:
    >6he8j (j:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records:
    >6he8k (k:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records:
    >6he8l (l:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records:
    >6he8m (m:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records:
    >6he8n (n:)
    tttvglvckdgvvmatekratmgnfiaskaakkiyqiadrmamttagsvgdaqflariik
    ieanlyeirrerkptvraiatltsnllnsyryfpylvqlliggidsegksiysidpigga
    ieekdivatgsgsltaygvledrftpeigvdeavelavraiysamkrdsasgdgidvvki
    tedefyqyspeeveqilakfrk