PDB entry 6he6

View 6he6 on RCSB PDB site
Description: crystal structure of extracellular domain 1 (ecd1) of ftsx from s. pneumonie in complex with dodecane-trimethylamine
Deposited on 2018-08-20, released 2019-04-24
The last revision was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein FtsX
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ERS044004_00806
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cell division protein FtsX
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: ERS044004_00806
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CAT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6he6A (A:)
klatdiennvrvvvyirkdvednsqtiekegqtvtnndyhkvydslknmstvksvtfssk
eeqyeklteimgdnwkifegdanplydayiveanapndvktiaedakkiegvsevqd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6he6B (B:)
klatdiennvrvvvyirkdvednsqtiekegqtvtnndyhkvydslknmstvksvtfssk
eeqyeklteimgdnwkifegdanplydayiveanapndvktiaedakkiegvsevqd