PDB entry 6hdv

View 6hdv on RCSB PDB site
Description: The crystal structure of intact afifavidin apo form
Class: biotin binding protein
Keywords: avidin-biotin system, bacterial avidins, self assembly, dimeric avidins, biotin binding protein
Deposited on 2018-08-20, released 2018-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDV (Start-137)
    Domains in SCOPe 2.07: d6hdva_
  • Chain 'B':
    Compound: Afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDV (Start-137)
    Domains in SCOPe 2.07: d6hdvb_
  • Chain 'C':
    Compound: Afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDV (Start-137)
    Domains in SCOPe 2.07: d6hdvc_
  • Chain 'D':
    Compound: Afifavidin
    Species: Afifella pfennigii [TaxId:209897]
    Database cross-references and differences (RAF-indexed):
    • PDB 6HDV (Start-137)
    Domains in SCOPe 2.07: d6hdvd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hdvA (A:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamketpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdvA (A:)
    qdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplv
    gltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgs
    dtftlvnkamketpkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hdvB (B:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamketpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdvB (B:)
    qdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplv
    gltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgs
    dtftlvnkamketpkm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hdvC (C:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamketpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdvC (C:)
    qdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplv
    gltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgs
    dtftlvnkamketpkm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hdvD (D:)
    maqdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyp
    lvgltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqq
    gsdtftlvnkamketpkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdvD (D:)
    qdmsprqsaeafgvpavssswvnqdgstmtlvfgagnsvsgfyvnnapgfgcqgtpyplv
    gltwgnfigftvawdnatancnsvtswtgfaeaagsdvtivtdwnlayqgsssgeiqqgs
    dtftlvnkamketpkm