PDB entry 6hdu

View 6hdu on RCSB PDB site
Description: Crystal structure of human Rab38 in complex with GTP
Class: signaling protein
Keywords: Rab small GTPase, membrane trafficking, cellular dynamics, SIGNALING PROTEIN
Deposited on 2018-08-19, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-38
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57729 (3-183)
      • expression tag (2)
      • engineered mutation (71)
    Domains in SCOPe 2.07: d6hdua1, d6hdua2
  • Chain 'B':
    Compound: Ras-related protein Rab-38
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57729 (3-End)
      • expression tag (2)
      • engineered mutation (71)
    Domains in SCOPe 2.07: d6hdub1, d6hdub2
  • Chain 'C':
    Compound: Ras-related protein Rab-38
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57729 (3-End)
      • engineered mutation (71)
    Domains in SCOPe 2.07: d6hduc_
  • Chain 'D':
    Compound: Ras-related protein Rab-38
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB38
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57729 (3-183)
      • expression tag (1-2)
      • engineered mutation (71)
    Domains in SCOPe 2.07: d6hdud1, d6hdud2
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hduA (A:)
    gshmqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpet
    vvrlqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpng
    kpvsvvllankcdqgkdvlmnnglkmdqfckehgfvgwfetsakeninideasrclvkhi
    lane
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hduA (A:)
    hmqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvv
    rlqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkp
    vsvvllankcdqkmdqfckehgfvgwfetsakeninideasrclvkhilane
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hduB (B:)
    gshmqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpet
    vvrlqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpng
    kpvsvvllankcdqgkdvlmnnglkmdqfckehgfvgwfetsakeninideasrclvkhi
    lane
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hduB (B:)
    hmqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvv
    rlqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkp
    vsvvllankcdqmdqfckehgfvgwfetsakeninideasrclvkhilan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hduC (C:)
    gshmqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpet
    vvrlqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpng
    kpvsvvllankcdqgkdvlmnnglkmdqfckehgfvgwfetsakeninideasrclvkhi
    lane
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hduC (C:)
    mqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetvvr
    lqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngkpv
    svvllankcdqkmdqfckehgfvgwfetsakeninideasrclvkhilan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hduD (D:)
    gshmqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpet
    vvrlqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpng
    kpvsvvllankcdqgkdvlmnnglkmdqfckehgfvgwfetsakeninideasrclvkhi
    lane
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hduD (D:)
    shmqaphkehlykllvigdlgvgktsiikryvhqnfsshyratigvdfalkvlhwdpetv
    vrlqlwdiaglerfgnmtrvyyreamgafivfdvtrpatfeavakwkndldsklslpngk
    pvsvvllankcdqkmdqfckehgfvgwfetsakeninideasrclvkhilane