PDB entry 6hdo

View 6hdo on RCSB PDB site
Description: crystal structure of human atad2 bromodomain in complex with 8-(((1r, 2r,3r,5s)-2-(2-(1,1-dioxidotetrahydro-2h-thiopyran-4-yl)ethyl)-8- azabicyclo[3.2.1]octan-3-yl)amino)-3-methyl-5-(5-methylpyridin-3-yl) quinolin-2(1h)-one
Deposited on 2018-08-18, released 2018-09-26
The last revision was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase family AAA domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ATAD2, L16, PRO2000
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PL18 (2-129)
      • expression tag (0-1)
  • Heterogens: EDO, FZH, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hdoA (A:)
smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
qlceeiqesr