PDB entry 6hde

View 6hde on RCSB PDB site
Description: Structure of Escherichia coli dUTPase Q93H mutant
Class: hydrolase
Keywords: dUTPase, homotrimer, mutant, HYDROLASE
Deposited on 2018-08-17, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: dut, dnaS, sof, b3640, JW3615
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-151)
      • initiating methionine (0)
      • engineered mutation (93)
    Domains in SCOPe 2.07: d6hdea_
  • Chain 'B':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: dut, dnaS, sof, b3640, JW3615
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-151)
      • initiating methionine (0)
      • engineered mutation (93)
    Domains in SCOPe 2.07: d6hdeb_
  • Chain 'C':
    Compound: deoxyuridine 5'-triphosphate nucleotidohydrolase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: dut, dnaS, sof, b3640, JW3615
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06968 (1-End)
      • initiating methionine (0)
      • engineered mutation (93)
    Domains in SCOPe 2.07: d6hdec_
  • Heterogens: DUP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hdeA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyhgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdeA (A:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyhgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfrgeggfghsgrq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hdeB (B:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyhgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hdeC (C:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyhgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfdatdrgeggfghsgrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hdeC (C:)
    mmkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihia
    dpslaammlprsglghkhgivlgnlvglidsdyhgqlmisvwnrgqdsftiqpgeriaqm
    ifvpvvqaefnlvedfd