PDB entry 6hd3

View 6hd3 on RCSB PDB site
Description: Common mode of remodeling AAA ATPases p97/CDC48 by their disassembly cofactors ASPL/PUX1
Class: plant protein
Keywords: ATPase, Arabidopsis thaliana, CDC48, hexamer, PLANT PROTEIN
Deposited on 2018-08-17, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 48 homolog A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CDC48A, CDC48, At3g09840, F8A24.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cell division control protein 48 homolog A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CDC48A, CDC48, At3g09840, F8A24.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hd3c1, d6hd3c2, d6hd3c3
  • Heterogens: PO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hd3C (C:)
    mstpaessdskskkdfstailerkkspnrlvvdeainddnsvvslhpatmeklqlfrgdt
    ilikgkkrkdtvcialadetceepkirmnkvvrsnlrvrlgdvisvhqcpdvkygkrvhi
    lpvddtvegvtgnlfdaylkpyfleayrpvrkgdlflvrggmrsvefkvietdpaeycvv
    apdteifcegepvkredeerlddvgyddvggvrkqmaqirelvelplrhpqlfksigvkp
    pkgillygppgsgktliaravanetgafffcingpeimsklagesesnlrkafeeaekna
    psiifideidsiapkrektngeverrivsqlltlmdglksrahvivmgatnrpnsidpal
    rrfgrfdreidigvpdeigrlevlrihtknmklaedvdleriskdthgyvgadlaalcte
    aalqcirekmdvidleddsidaeilnsmavtnehfhtalgnsnpsalretvvevpnvswn
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hd3C (C:)
    kspnrlvvdeainddnsvvslhpatmeklqlfrgdtilikgkkrkdtvcialadetceep
    kirmnkvvrsnlrvrlgdvisvhqcpdvkygkrvhilpvddtvegvtgnlfdaylkpyfl
    eayrpvrkgdlflvrggmrsvefkvietdpaeycvvapdteifcegepvkredeerlddv
    gyddvggvrkqmaqirelvelplrhpqlfksigvkppkgillygppgsgktliaravane
    tgafffcingpeimsklagesesnlrkafeeaeknapsiifideidsiapkrektngeve
    rrivsqlltlmdglksrahvivmgatnrpnsidpalrrfgrfdreidigvpdeigrlevl
    rihtknmklaedvdleriskdthgyvgadlaalcteaalqcirekmdvddsidaeilnsm
    avtnehfhtalgnsn