PDB entry 6hcu

View 6hcu on RCSB PDB site
Description: Crystal Structure of Lysyl-tRNA Synthetase from Plasmodium falciparum bound to a difluoro cyclohexyl chromone ligand
Class: transferase
Keywords: adenylyltransferase activity, tRNA binding, ligase, transferase
Deposited on 2018-08-16, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF3D7_1350100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcua1, d6hcua2
  • Chain 'B':
    Compound: Lysine--tRNA ligase
    Species: Plasmodium falciparum 3D7 [TaxId:36329]
    Gene: PF3D7_1350100
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hcub1, d6hcub2
  • Heterogens: FYB, LYS, PEG, HIS, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hcuA (A:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hcuA (A:)
    vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
    rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg
    kskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtki
    inflrnflnergffevetpmmnliaarpfithhndldldlylriatelplkmlivggidk
    vyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykisyn
    kdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkielpn
    pptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgkev
    lnaytelndpfkqkecfldsafctsleyglpptgglglgidritmfltnknsikdvilfp
    tmrpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hcuB (B:)
    evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit
    grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp
    gkskkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtk
    iinflrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmliv
    ggidkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgty
    kisynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehk
    ielpnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemfi
    cgkevlnaytelndpfkqkecfklqqkdrekgdteaaqldsafctsleyglpptgglglg
    idritmfltnknsikdvilfptmrpan
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hcuB (B:)
    vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
    rimrvsaqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
    kkgelsifpketillsaclhmlpmkyglkdteiryrqryldllinessrhtfvtrtkiin
    flrnflnergffevetpmmnliagganarpfithhndldldlylriatelplkmlivggi
    dkvyeigkvfrnegidnthnpeftscefywayadyndlikwsedffsqlvyhlfgtykis
    ynkdgpenqpieidftppypkvsiveeiekvtntileqpfdsnetiekminiikehkiel
    pnpptaaklldqlashfienkyndkpffivehpqimsplakyhrtkpglterlemficgk
    evlnaytelndpfkqkecfsafctsleyglpptgglglgidritmfltnknsikdvilfp
    tmrpa