PDB entry 6hct

View 6hct on RCSB PDB site
Description: crystal structure of archeoglobus fulgidus l7ae bound to its cognate utr k-turn
Deposited on 2018-08-16, released 2018-10-31
The last revision was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA (5'-r(*gp*cp*cp*gp*ap*up*gp*ap*ap*up*gp*cp*ap*up*gp*ap*ap*gp*c)-3')
    Species: Archaeoglobus fulgidus DSM 4304, synthetic [TaxId:224325]
  • Chain 'B':
    Compound: RNA (5'-r(*gp*cp*cp*gp*ap*up*gp*ap*ap*up*gp*cp*ap*up*gp*ap*ap*gp*c)-3')
    Species: Archaeoglobus fulgidus DSM 4304, synthetic [TaxId:224325]
  • Chain 'C':
    Compound: 50S ribosomal protein L7Ae
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: rpl7ae, AF_0764
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29494 (1-116)
      • expression tag (0)
  • Chain 'D':
    Compound: 50S ribosomal protein L7Ae
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: rpl7ae, AF_0764
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29494 (1-116)
      • expression tag (0)
  • Chain 'E':
    Compound: RNA (5'-r(*gp*cp*cp*gp*ap*up*gp*ap*ap*up*g)-3')
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
  • Chain 'F':
    Compound: RNA (5'-r(p*cp*ap*up*gp*ap*ap*gp*c)-3')
    Species: Archaeoglobus fulgidus DSM 4304, synthetic [TaxId:224325]
  • Chain 'G':
    Compound: 50S ribosomal protein L7Ae
    Species: Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) [TaxId:224325]
    Gene: rpl7ae, AF_0764
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29494 (1-116)
      • expression tag (0)
  • Heterogens: NA, SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6hctC (C:)
    syvrfevpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeiva
    hlpllceeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikgl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6hctD (D:)
    syvrfevpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeiva
    hlpllceeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikgl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6hctG (G:)
    syvrfevpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeiva
    hlpllceeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikgl