PDB entry 6hcc

View 6hcc on RCSB PDB site
Description: structure of glua2 ligand-binding domain (s1s2j-n775s) in complex with glutamate and tdpam02 at 1.6 a resolution.
Class: membrane protein
Keywords: ampa receptor, gluA2, ligand-binding domain, glua2-S1S2J-N775S, membrane protein, signaling protein, positive allosteric modulator
Deposited on 2018-08-14, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • expression tag (0-1)
      • linker (117-118)
    • Uniprot P19491 (119-263)
      • engineered mutation (241)
    Domains in SCOPe 2.07: d6hcca1, d6hcca2
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • expression tag (0-1)
      • linker (117-118)
    • Uniprot P19491 (119-263)
      • engineered mutation (241)
    Domains in SCOPe 2.07: d6hccb1, d6hccb2
  • Heterogens: FXW, GLU, SO4, GOL, PEG, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hccA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lseqglldklknkwwydkgecgsg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hccB (B:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lseqglldklknkwwydkgecgsg