PDB entry 6hc2

View 6hc2 on RCSB PDB site
Description: crystal structure of numa/lgn hetero-hexamers
Deposited on 2018-08-13, released 2019-05-29
The last revision was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 4.31 Å
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (2-5)
  • Chain 'B':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (0-5)
  • Chain 'D':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (1-5)
  • Chain 'F':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (0-5)
  • Chain 'H':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (0-5)
  • Chain 'J':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (1-5)
  • Chain 'L':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (1-5)
  • Chain 'N':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (2-5)
  • Chain 'P':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (0-5)
  • Chain 'R':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (1-5)
  • Chain 'T':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (1-5)
  • Chain 'V':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: G-protein-signaling modulator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GPSM2, LGN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81274 (6-366)
      • expression tag (1-5)
  • Chain 'X':
    Compound: Nuclear mitotic apparatus protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NUMA1, NMP22, NUMA
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hc2A (A:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2A (A:)
    lgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysqlg
    nayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrhl
    disrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyeenl
    slvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnlg
    nayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkhl
    aiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnls
    dlqmv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hc2B (B:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2B (B:)
    dygnsallslpgyrpttpgrnsfymgtcqdepeqlddwnriaelq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6hc2C (C:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6hc2D (D:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2D (D:)
    nsallslpgyrpfymgtcqdepeqlddwnriaelqq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6hc2E (E:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2E (E:)
    plgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysql
    gnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrh
    ldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyeen
    lslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnl
    gnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkh
    laiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnl
    sdlqmv
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6hc2F (F:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2F (F:)
    llslpgyrpsfymgtcqdepeqlddwnriaelqqrnr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >6hc2G (G:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6hc2H (H:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2H (H:)
    allslpgyrpttfymgtcqdepeqlddwnriaelqq
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >6hc2I (I:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6hc2J (J:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2J (J:)
    gnsallslpgyrpttsfymgtcqdepeqlddwnriaelqq
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6hc2K (K:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2K (K:)
    plgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysql
    gnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrh
    ldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyeen
    lslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnl
    gnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkh
    laiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnl
    sdlqmv
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6hc2L (L:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2L (L:)
    dygnsallslpgyrpttfymgtcqdepeqlddwnriaelqqrnr
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6hc2M (M:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2M (M:)
    plgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysql
    gnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrh
    ldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyeen
    lslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnl
    gnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkh
    laiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnl
    sdlqmv
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >6hc2N (N:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2N (N:)
    nsallslpgyrptfymgtcqdepeqlddwnriaelqqrn
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >6hc2O (O:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2O (O:)
    lgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysqlg
    nayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrhl
    disrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyeenl
    slvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnlg
    nayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkhl
    aiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnls
    dlqmv
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6hc2P (P:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2P (P:)
    nsallslpgyrptgrnsfymgtcqdepeqlddwnriaelqqrn
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >6hc2Q (Q:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >6hc2R (R:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2R (R:)
    nsallslpgyrpttfymgtcqdepeqlddwnriaelqqrn
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >6hc2S (S:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2S (S:)
    plgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysql
    gnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrh
    ldisrelndkvgearalynlgnvyhakgksfgcpgpqfpeevrdalqaavdfyeenlslv
    talgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnlgnay
    iflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkhlaia
    qelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnlsdlq
    mv
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >6hc2T (T:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2T (T:)
    gnsallslpgyrpttrsrnsfymgtcqdepeqlddwnriaelqqr
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >6hc2U (U:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2U (U:)
    plgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysql
    gnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrh
    ldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyeen
    lslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnl
    gnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkh
    laiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnl
    sdlqmv
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >6hc2V (V:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2V (V:)
    nsallslpgyrrnsfymgtcqdepeqlddwnriaelqqr
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >6hc2W (W:)
    gplgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysq
    lgnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqr
    hldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyee
    nlslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysn
    lgnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlk
    hlaiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarln
    lsdlqmv
    

    Sequence, based on observed residues (ATOM records):
    >6hc2W (W:)
    plgsmfhvryrmeasclelalegerlcksgdcragvsffeaavqvgtedlktlsaiysql
    gnayfylhdyakaleyhhhdltlartigdqlgeakasgnlgntlkvlgnfdeaivccqrh
    ldisrelndkvgearalynlgnvyhakgksfgcpgpqdvgefpeevrdalqaavdfyeen
    lslvtalgdraaqgrafgnlgnthyllgnfrdaviaheqrlliakefgdkaaerraysnl
    gnayiflgefetaseyykktlllarqlkdraveaqscyslgntytllqdyekaidyhlkh
    laiaqelndrigegracwslgnaytalgnhdqamhfaekhleisrevgdksgeltarlnl
    sdlqmv
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >6hc2X (X:)
    gplgspdygnsallslpgyrpttrssarrsqagvssgappgrnsfymgtcqdepeqlddw
    nriaelqqrnr
    

    Sequence, based on observed residues (ATOM records):
    >6hc2X (X:)
    gnsallslpgyrpttrfymgtcqdepeqlddwnriaelqq