PDB entry 6hc1

View 6hc1 on RCSB PDB site
Description: Bdellovibrio bacteriovorus DgcB FHA in complex with phosphorylated N-terminal peptide
Class: signaling protein
Keywords: GGDEF, FHA, c-di-GMP, diguanylate cyclase, SIGNALING PROTEIN
Deposited on 2018-08-13, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus HD100 [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6MPU8 (1-102)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6hc1a_
  • Chain 'B':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus HD100 [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6MPU8 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6hc1b_
  • Chain 'C':
    Compound: DgcB N-terminus, phosphorylated
    Species: Bdellovibrio bacteriovorus HD100 [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed):
    • PDB 6HC1 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hc1A (A:)
    mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hc1B (B:)
    mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hc1B (B:)
    mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekg
    

  • Chain 'C':
    No sequence available.