PDB entry 6hc1

View 6hc1 on RCSB PDB site
Description: Bdellovibrio bacteriovorus DgcB FHA in complex with phosphorylated N-terminal peptide
Class: signaling protein
Keywords: GGDEF, FHA, c-di-GMP, diguanylate cyclase, SIGNALING PROTEIN
Deposited on 2018-08-13, released 2019-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GGDEF domain protein
  Species: Bdellovibrio bacteriovorus HD100 [TaxId:264462]
  Gene: Bd0742
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6MPU8 (1-102)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6hc1a_
• Chain 'B':
  Compound: GGDEF domain protein
  Species: Bdellovibrio bacteriovorus HD100 [TaxId:264462]
  Gene: Bd0742
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6MPU8 (1-End)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6hc1b_
• Chain 'C':
  Compound: DgcB N-terminus, phosphorylated
  Species: Bdellovibrio bacteriovorus HD100 [TaxId:264462]
  Gene: Bd0742
  Database cross-references and differences (RAF-indexed):
  • PDB 6HC1 (0-End)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6hc1A (A:)
  mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
  dlgstnktivngqvipplascllknndqiktgnvifkflekgs
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >6hc1B (B:)
  mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
  dlgstnktivngqvipplascllknndqiktgnvifkflekgs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6hc1B (B:)
  mppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
  dlgstnktivngqvipplascllknndqiktgnvifkflekg
  

  
  
• Chain 'C':
  No sequence available.