PDB entry 6hc0

View 6hc0 on RCSB PDB site
Description: Bdellovibrio bacteriovorus DgcB FHA domain, tail complex
Class: signaling protein
Keywords: GGDEF, FHA, c-di-GMP, diguanylate cyclase, SIGNALING PROTEIN
Deposited on 2018-08-13, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DgcB N-terminus
    Species: Bdellovibrio bacteriovorus HD100 [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed):
    • PDB 6HC0 (0-6)
  • Chain 'B':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hc0b_
  • Chain 'C':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hc0c_
  • Chain 'D':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hc0d_
  • Chain 'E':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hc0e_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hc0B (B:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hc0C (C:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hc0C (C:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hc0D (D:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hc0D (D:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6hc0E (E:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hc0E (E:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgs