PDB entry 6hbz

View 6hbz on RCSB PDB site
Description: bdellovibrio bacteriovorus dgcb full-length
Deposited on 2018-08-13, released 2019-08-28
The last revision was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GGDEF domain protein
    Species: Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) [TaxId:264462]
    Gene: Bd0742
    Database cross-references and differences (RAF-indexed):
  • Heterogens: C2E, CL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hbzA (A:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsieamtnaamydraqkda
    ltgahskgalldkgpeamkraevlnepfslvtfdidhfkkindsyghpggdyvlkelcri
    vitklirsndffaryggeefvlllsgspsktagevgerirqtieahdftfegkkipvtis
    vgvatklpnetewtqvydradkalyqskqggrnrttiva
    

    Sequence, based on observed residues (ATOM records):
    >6hbzA (A:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsydraqkdaltgahskga
    lldkgpeamkraevlnepfslvtfdidhfkkindsyghpggdyvlkelcrivitklirsn
    dffaryggeefvlllsgspsktagevgerirqtieahdftfegkkipvtisvgvatklpn
    etewtqvydradkalyqskqggrnrttiv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hbzB (B:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsieamtnaamydraqkda
    ltgahskgalldkgpeamkraevlnepfslvtfdidhfkkindsyghpggdyvlkelcri
    vitklirsndffaryggeefvlllsgspsktagevgerirqtieahdftfegkkipvtis
    vgvatklpnetewtqvydradkalyqskqggrnrttiva
    

    Sequence, based on observed residues (ATOM records):
    >6hbzB (B:)
    vppaivvligppgyvgkqypitasdivigrsvesqvyiddkslsrshakfavngsevsvi
    dlgstnktivngqvipplascllknndqiktgnvifkflekgsydraqkdaltgahskga
    lldkgpeamkraevlnepfslvtfdidhfkkindsyghpggdyvlkelcrivitklirsn
    dffaryggeefvlllsgspsktagevgerirqtieahdftfegkkipvtisvgvatklpn
    etewtqvydradkalyqskqggrnrttiva