PDB entry 6hbv

View 6hbv on RCSB PDB site
Description: Structure of PLP internal aldimine form of Sphingopyxis sp. MTA144 FumI protein
Class: transferase
Keywords: aminotransferase, PLP, fumonisin, TRANSFERASE
Deposited on 2018-08-13, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopentol aminotransferase
    Species: Sphingopyxis macrogoltabida [TaxId:33050]
    Gene: fumI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hbva_
  • Chain 'B':
    Compound: Aminopentol aminotransferase
    Species: Sphingopyxis macrogoltabida [TaxId:33050]
    Gene: fumI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hbvb_
  • Heterogens: PLP, PMP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hbvA (A:)
    mangtrqkdlreraervipggmyghestrllppefpqffrralgariwdadeqpyidymc
    aygpnllgyrqseieaaadaqrllgdtmtgpseimvnlaeafvgmvrhadwamfckngsd
    atstamvlarahtgrktilcakgayhgaspwntphtagilasdrvhvayytyndaqslsd
    afkahdgdiaavfatpfrhevfedqalaqlefartarkccdetgallvvddvragfrvar
    dcswthlgiepdlscwgkcfangypisallgsnkardaardifvtgsfwfsavpmaaaie
    tlriiretpyletliasgaalragleaqsqrhglelkqtgpaqmpqiffaddpdfrigya
    waaaclkggvyvhpyhnmflsaahtvddvtetleatdrafsavlrdfaslqphpilmqla
    gaassvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbvA (A:)
    gtrqkdlreraervipggmyghestrllppefpqffrralgariwdadeqpyidymcayg
    pnllgyrqseieaaadaqrllgdtmtgpseimvnlaeafvgmvrhadwamfckngsdats
    tamvlarahtgrktilcakgayhgaspwntphtagilasdrvhvayytyndaqslsdafk
    ahdgdiaavfatpfrhevfedqalaqlefartarkccdetgallvvddvragfrvardcs
    wthlgiepdlscwgkcfangypisallgsnkardaardifvtgsfwfsavpmaaaietlr
    iiretpyletliasgaalragleaqsqrhglelkqtgpaqmpqiffaddpdfrigyawaa
    aclkggvyvhpyhnmflsaahtvddvtetleatdrafsavlrdfaslqphpilm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hbvB (B:)
    mangtrqkdlreraervipggmyghestrllppefpqffrralgariwdadeqpyidymc
    aygpnllgyrqseieaaadaqrllgdtmtgpseimvnlaeafvgmvrhadwamfckngsd
    atstamvlarahtgrktilcakgayhgaspwntphtagilasdrvhvayytyndaqslsd
    afkahdgdiaavfatpfrhevfedqalaqlefartarkccdetgallvvddvragfrvar
    dcswthlgiepdlscwgkcfangypisallgsnkardaardifvtgsfwfsavpmaaaie
    tlriiretpyletliasgaalragleaqsqrhglelkqtgpaqmpqiffaddpdfrigya
    waaaclkggvyvhpyhnmflsaahtvddvtetleatdrafsavlrdfaslqphpilmqla
    gaassvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbvB (B:)
    gtrqkdlreraervipggmyghestrllppefpqffrralgariwdadeqpyidymcayg
    pnllgyrqseieaaadaqrllgdtmtgpseimvnlaeafvgmvrhadwamfckngsdats
    tamvlarahtgrktilcakgayhgaspwntphtagilasdrvhvayytyndaqslsdafk
    ahdgdiaavfatpfrhevfedqalaqlefartarkccdetgallvvddvragfrvardcs
    wthlgiepdlscwgkcfangypisallgsnkardaardifvtgsfwfsavpmaaaietlr
    iiretpyletliasgaalragleaqsqrhglelkqtgpaqmpqiffaddpdfrigyawaa
    aclkggvyvhpyhnmflsaahtvddvtetleatdrafsavlrdfaslqphp