PDB entry 6hbl

View 6hbl on RCSB PDB site
Description: echovirus 18 open particle without three pentamers
Deposited on 2018-08-10, released 2019-03-20
The last revision was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: EM
Resolution: 3.7 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'n':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'p':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'q':
    Compound: Echovirus 18 capsid protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Echovirus 18 capsid protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 's':
    Compound: Echovirus 18 capsid protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hblA (A:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblA (A:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hblB (B:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblB (B:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6hblC (C:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblC (C:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6hblD (D:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblD (D:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6hblE (E:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblE (E:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6hblF (F:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblF (F:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6hblG (G:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblG (G:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6hblH (H:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblH (H:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6hblI (I:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblI (I:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6hblJ (J:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblJ (J:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >6hblK (K:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblK (K:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6hblL (L:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblL (L:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6hblM (M:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblM (M:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >6hblN (N:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblN (N:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >6hblO (O:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblO (O:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >6hblP (P:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblP (P:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >6hblQ (Q:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblQ (Q:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >6hblR (R:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblR (R:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >6hblS (S:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblS (S:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'T':
    Sequence, based on SEQRES records:
    >6hblT (T:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblT (T:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'U':
    Sequence, based on SEQRES records:
    >6hblU (U:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblU (U:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'V':
    Sequence, based on SEQRES records:
    >6hblV (V:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblV (V:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'W':
    Sequence, based on SEQRES records:
    >6hblW (W:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblW (W:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'X':
    Sequence, based on SEQRES records:
    >6hblX (X:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblX (X:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'Y':
    Sequence, based on SEQRES records:
    >6hblY (Y:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblY (Y:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'Z':
    Sequence, based on SEQRES records:
    >6hblZ (Z:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblZ (Z:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'a':
    Sequence, based on SEQRES records:
    >6hbla (a:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hbla (a:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'b':
    Sequence, based on SEQRES records:
    >6hblb (b:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblb (b:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'c':
    Sequence, based on SEQRES records:
    >6hblc (c:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblc (c:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'd':
    Sequence, based on SEQRES records:
    >6hbld (d:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hbld (d:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'e':
    Sequence, based on SEQRES records:
    >6hble (e:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hble (e:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'f':
    Sequence, based on SEQRES records:
    >6hblf (f:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblf (f:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'g':
    Sequence, based on SEQRES records:
    >6hblg (g:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblg (g:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'h':
    Sequence, based on SEQRES records:
    >6hblh (h:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblh (h:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'i':
    Sequence, based on SEQRES records:
    >6hbli (i:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hbli (i:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'j':
    Sequence, based on SEQRES records:
    >6hblj (j:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblj (j:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'k':
    Sequence, based on SEQRES records:
    >6hblk (k:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblk (k:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'l':
    Sequence, based on SEQRES records:
    >6hbll (l:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hbll (l:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'm':
    Sequence, based on SEQRES records:
    >6hblm (m:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblm (m:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'n':
    Sequence, based on SEQRES records:
    >6hbln (n:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hbln (n:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'o':
    Sequence, based on SEQRES records:
    >6hblo (o:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblo (o:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 'p':
    Sequence, based on SEQRES records:
    >6hblp (p:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hblp (p:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma
    

  • Chain 'q':
    Sequence, based on SEQRES records:
    >6hblq (q:)
    gdnqdrtvantqpsgpsnsteipaltavetghtsqvdpsdtiqtrhvvnfhsrsestien
    fmgraacvfmdqykingeetstdrfavwtiniremaqlrrkcemftymrfdiemtmvits
    cqdqgtildqdmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegnapprisipf
    isvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitstirvyfkpkhi
    kawvprpprlcpyinkrdvnfvvteitdsrtsitdtphpehsvlath
    

    Sequence, based on observed residues (ATOM records):
    >6hblq (q:)
    qtrhvvnfhsrsestienfmgraacvfmdqykingeetstdrfavwtiniremaqlrrkc
    emftymrfdiemtmvitscqmpvlthqimyvppggpipakvdgyewqtstnpsvfwtegn
    apprisipfisvgnayssfydgwshftqdgtygyttlnamgklyirhvnrssphqitsti
    rvyfkpkhikawvprpprlcpyinkrdvnfvvteitdsrtsitd
    

  • Chain 'r':
    Sequence, based on SEQRES records:
    >6hblr (r:)
    spsaeecgysdrvrsmtlgnstittqesanvvvgygewpsylsdreataedqptqpdvat
    crfytlesvqwektspgwwwkfpealknmglfgqnmhyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcadtdttfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgn
    ltifphqwinlrtnnsativipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpi
    tvtiapmyaeynglrlastq
    

    Sequence, based on observed residues (ATOM records):
    >6hblr (r:)
    vrsmtlgnstittqnvvvgygewpsylstaedqptqpdvatcrfytlesvqwektspgww
    wkfpealknmglfgqnmhyhylgragytihvqcnaskfhqgcllvvcvpeaemgcadtdt
    tfpatelttedtphvftsdsitgkkvqaavcnagmgvgvgnltifphqwinlrtnnsati
    vipyinsvpmdnmfrhynftlmiipfaplnftdgatayvpitvtiapmyaeynglrla
    

  • Chain 's':
    Sequence, based on SEQRES records:
    >6hbls (s:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records):
    >6hbls (s:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfcgs
    amatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqssagyitcwy
    qtnivvppgaptscdvlcfasacndfsvrllrdtpfma