PDB entry 6hbj

View 6hbj on RCSB PDB site
Description: Echovirus 18 empty particle
Class: virus
Keywords: echovirus, echovirus 18, empty particle, B-particle, enterovirus, picornavirus, VIRUS
Deposited on 2018-08-10, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: EM
Resolution: 3.16 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral protein 1
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: viral protein 2
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: viral protein 3
    Species: Echovirus E18 [TaxId:47506]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hbjc_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hbjC (C:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgtgntdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltfl
    fcgsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqshyrmv
    qqdpytsagyitcwyqtnivvppgaptscdvlcfasacndfsvrllrdtpfmaqpgklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbjC (C:)
    gvpvlntpgsnqfltsddyqspsampqfdetpemhipgevrnlmeiaevdsvvpvnnvtg
    ktksmdayqipvgttdktkpifsfqmdpgyssvlkrtllgemlnyyahwsgsvkltflfc
    gsamatgkllisysppgasvptsrkdamlgthivwdiglqsscvlcvpwisqsagyitcw
    yqtnivvppgaptscdvlcfasacndfsvrllrdtpfma