PDB entry 6hbi

View 6hbi on RCSB PDB site
Description: scapharca dimeric hemoglobin, mutant t72v, deoxy form
Class: oxygen transport
Keywords: oxygen transport, heme, respiratory protein
Deposited on 1998-06-25, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered (71)
    Domains in SCOPe 2.07: d6hbia_
  • Chain 'B':
    Compound: hemoglobin
    Species: Scapharca inaequivalvis [TaxId:6561]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02213 (Start-145)
      • engineered (71)
    Domains in SCOPe 2.07: d6hbib_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hbiA (A:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsivlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbiA (A:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsivlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hbiB (B:)
    psvydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqg
    mandklrghsivlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikk
    vlasknfgdkyanawaklvavvqaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hbiB (B:)
    svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
    andklrghsivlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
    lasknfgdkyanawaklvavvqaal