PDB entry 6hbb

View 6hbb on RCSB PDB site
Description: crystal structure of the small subunit-like domain 1 of ccmm from synechococcus elongatus (strain pcc 7942)
Deposited on 2018-08-10, released 2018-12-12
The last revision was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide concentrating mechanism protein CcmM
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: ccmM, Synpcc7942_1423
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03513 (3-End)
      • expression tag (2)
  • Chain 'B':
    Compound: Carbon dioxide concentrating mechanism protein CcmM
    Species: Synechococcus elongatus (strain PCC 7942) [TaxId:1140]
    Gene: ccmM, Synpcc7942_1423
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03513 (3-End)
      • expression tag (2)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hbbA (A:)
seflssevitqvrsllnqgyrigtehadkrrfrtsswqpcapiqstnerqvlselencls
ehegeyvrllgidtntrsrvfealiqrpdgsv

    Sequence, based on observed residues (ATOM records):
    >6hbbA (A:)
flssevitqvrsllnqgyrigtehadkrrfrtsswqpcapiqstnerqvlselenclseh
egeyvrllgidtntrsrvfealiqrpdg

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hbbB (B:)
seflssevitqvrsllnqgyrigtehadkrrfrtsswqpcapiqstnerqvlselencls
ehegeyvrllgidtntrsrvfealiqrpdgsv

    Sequence, based on observed residues (ATOM records):
    >6hbbB (B:)
flssevitqvrsllnqgyrigtehadkrrfrtsswqpcapiqstnerqvlselenclseh
egeyvrllgidtntrsrvfealiqrpdgs