PDB entry 6hb9

View 6hb9 on RCSB PDB site
Description: Crystal structure of the GABARAP in complex with the UBA5 LIR motif
Class: signaling protein
Keywords: GABARAP, UBA5 LIR motif, complex, SIGNALING PROTEIN
Deposited on 2018-08-10, released 2019-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Gamma-aminobutyric acid receptor-associated protein
  Species: Homo sapiens [TaxId:9606]
  Gene: GABARAP, FLC3B, HT004
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95166 (15-128)
    • expression tag (0-14)
  Domains in SCOPe 2.08: d6hb9a1, d6hb9a2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6hb9A (A:)
  ewgielvsevseamgfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkk
  kylvpsdltvgqfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyi
  aysdesvyg