PDB entry 6hb8

View 6hb8 on RCSB PDB site
Description: Crystal structure of OXA-517 beta-lactamase
Class: hydrolase
Keywords: beta-lactamase, HYDROLASE
Deposited on 2018-08-09, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaOXA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hb8a1, d6hb8a2
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaOXA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1U8YI81 (Start-243)
      • expression tag (244)
    Domains in SCOPe 2.07: d6hb8b1, d6hb8b2
  • Chain 'C':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaOXA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hb8c1, d6hb8c2
  • Chain 'D':
    Compound: Beta-lactamase
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: blaOXA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1U8YI81 (Start-243)
      • expression tag (244)
    Domains in SCOPe 2.07: d6hb8d1, d6hb8d2
  • Heterogens: SO4, ETX, GOL, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hb8A (A:)
    mvakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsli
    aldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskml
    hafdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltea
    ngdyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqe
    kiipfehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hb8A (A:)
    vakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslia
    ldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlh
    afdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltean
    gdyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqek
    iipf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hb8B (B:)
    mvakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsli
    aldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskml
    hafdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltea
    ngdyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqe
    kiipfehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hb8B (B:)
    akewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslial
    dlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlha
    fdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteang
    dyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
    ipf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6hb8C (C:)
    mvakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsli
    aldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskml
    hafdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltea
    ngdyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqe
    kiipfehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hb8C (C:)
    vakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslia
    ldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlh
    afdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltean
    gdyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqek
    iipf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6hb8D (D:)
    mvakewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsli
    aldlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskml
    hafdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamltea
    ngdyiiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqe
    kiipfehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hb8D (D:)
    ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
    gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
    ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
    iiraktgystkpkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
    f