PDB entry 6haz

View 6haz on RCSB PDB site
Description: Crystal structure of the bromodomain of human SMARCA2 in complex with SMARCA-BD ligand
Class: gene regulation
Keywords: bromodomain, GENE REGULATION
Deposited on 2018-08-09, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable global transcription activator SNF2L2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA2, BAF190B, BRM, SNF2A, SNF2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6haza_
  • Chain 'B':
    Compound: Probable global transcription activator SNF2L2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA2, BAF190B, BRM, SNF2A, SNF2L2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6hazb_
  • Heterogens: FX5, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6hazA (A:)
    smaeklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvd
    fkkikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak
    eee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hazA (A:)
    pnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkiker
    irnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6hazB (B:)
    smaeklspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvd
    fkkikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak
    eee
    

    Sequence, based on observed residues (ATOM records): (download)
    >6hazB (B:)
    pnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkiker
    irnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqkiak