PDB entry 6has

View 6has on RCSB PDB site
Description: crystal structure of the small subunit-like domain of rubisco activase from nostoc sp. (strain pcc 7120)
Deposited on 2018-08-08, released 2020-01-15
The last revision was dated 2021-01-27, with a file datestamp of 2021-01-22.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase/oxygenase activase
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: rca, alr1533
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase/oxygenase activase
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: rca, alr1533
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6hasA (A:)
hlsletqeqirqilsqghkitfehvdarrfrtgswqscgtlhidaesdaistleaclvdy
dgeyvrmvgidpkgkrrvvetiiqrpngkn

    Sequence, based on observed residues (ATOM records):
    >6hasA (A:)
hlsletqeqirqilsqghkitfehvdarrfrtgswqscgtlhidaesdaistleaclvdy
dgeyvrmvgidpkgkrrvvetiiqrpn

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6hasB (B:)
hlsletqeqirqilsqghkitfehvdarrfrtgswqscgtlhidaesdaistleaclvdy
dgeyvrmvgidpkgkrrvvetiiqrpngkn

    Sequence, based on observed residues (ATOM records):
    >6hasB (B:)
hlsletqeqirqilsqghkitfehvdarrfrtgswqscgtlhidaesdaistleaclvdy
dgeyvrmvgidpkgkrrvvetiiqrpn