PDB entry 6har

View 6har on RCSB PDB site
Description: Crystal structure of Mesotrypsin in complex with APPI-M17C/I18F/F34C
Class: protein fibril
Keywords: PRSS3, Mesotrypsin, Serine protease, Kunitz type inhibitor, APPI, protein fibril
Deposited on 2018-08-08, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PRSS3 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N2U3 (0-223)
      • conflict (176)
    Domains in SCOPe 2.08: d6hara_
  • Chain 'E':
    Compound: Amyloid-beta A4 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot H7C0V9 (17-End)
      • expression tag (12-16)
      • engineered mutation (26-27)
      • engineered mutation (43)
    Domains in SCOPe 2.08: d6hare1, d6hare2
  • Heterogens: EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6harA (A:)
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >6harE (E:)
yvdykddddkefevcseqaetgpcracfsrwyfdvtegkcapfcyggcggnrnnfdteey
cmavcgsaiprhhhhhhaaa

    Sequence, based on observed residues (ATOM records): (download) 
    >6harE (E:)
evcseqaetgpcracfsrwyfdvtegkcapfcyggcggnrnnfdteeycmavcg