PDB entry 6hap

View 6hap on RCSB PDB site
Description: adenylate kinase
Deposited on 2018-08-08, released 2019-08-28
The last revision was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: adk, EcE24377A_0513
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7ZIN4 (0-213)
      • conflict (68)
      • conflict (72)
      • conflict (76)
      • conflict (202)
  • Heterogens: AP5

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6hapA (A:)
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvrericqedsrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
yyskeaeagntkyakvdgtkpvcevradlekilg