PDB entry 6hac

View 6hac on RCSB PDB site
Description: Crystal structure of [Fe]-hydrogenase (Hmd) holoenzyme from Methanococcus aeolicus (open form)
Class: oxidoreductase
Keywords: [Fe]-hydrogenase, catalytic cycle, conformational rearrangement, Fe-guanylylpyridinol cofactor, methanogenesis, hydride-transfer, tetrahydromethanopterin, C1-metabolism, OXIDOREDUCTASE
Deposited on 2018-08-07, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methenyltetrahydromethanopterin hydrogenase
    Species: Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3) [TaxId:419665]
    Gene: hmd, Maeo_1025
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6haca1, d6haca2
  • Heterogens: FE9, 1PE, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6hacA (A:)
    mkvailgagcyrshaacgitnfsraaevankvgipeitmthstitmgaellhlvdeidev
    vvsdpcfaeepgliiidefdckevmeahlagkaedvmpairdavkakakdspkppkgcih
    fvnpekvglkvtsddreaiegadivitwlpkggsqpaiiekfvdaikegaivthactipt
    pkfakifkdlgredlnivsfhpgcvpemkgqvylsegyaseeaveklykiakisrgtafk
    mpanlispvcdmgsavtapvyaailsyrdavtnilgapadfaqmmadeaitqmlelmrne
    giqnmenklnpgaltgtadsmcfgplsellpaslkvleehkk