PDB entry 6ha7

View 6ha7 on RCSB PDB site
Description: Crystal structure of the BiP NBD and MANF complex
Class: chaperone
Keywords: MANF, BiP, NBD, NDI, ARMET, HSP70, CHAPERONE
Deposited on 2018-08-07, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Cricetulus griseus [TaxId:10029]
    Gene: HSPA5, GRP78, I79_019946
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3I8R9 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6ha7a1, d6ha7a2, d6ha7a3
  • Chain 'B':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Cricetulus griseus [TaxId:10029]
    Gene: HSPA5, GRP78, I79_019946
    Database cross-references and differences (RAF-indexed):
    • Uniprot G3I8R9 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d6ha7b1, d6ha7b2, d6ha7b3
  • Chain 'C':
    Compound: Mesencephalic astrocyte-derived neurotrophic factor
    Species: Mus musculus [TaxId:10090]
    Gene: Manf, Armet
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Mesencephalic astrocyte-derived neurotrophic factor
    Species: Mus musculus [TaxId:10090]
    Gene: Manf, Armet
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ha7A (A:)
    sgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlts
    npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
    amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
    iaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehf
    iklykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrak
    feelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsr
    ginpdeavaygaavqagvlsgdqdtgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ha7A (A:)
    sgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlts
    npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
    amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
    iaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehf
    iklykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrak
    feelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsr
    ginpdeavaygaavqagvls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ha7B (B:)
    sgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlts
    npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
    amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
    iaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehf
    iklykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrak
    feelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsr
    ginpdeavaygaavqagvlsgdqdtgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ha7B (B:)
    sgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlts
    npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
    amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
    iaygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehf
    iklykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrak
    feelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsr
    ginpdeavaygaavqagvlsg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.