PDB entry 6ha4

View 6ha4 on RCSB PDB site
Description: crystal structure of paf - p-sulfonatocalix[4]arene complex
Deposited on 2018-08-07, released 2019-02-13
The last revision was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pc24g00380 protein
    Species: Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) [TaxId:500485]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: T3Y, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6ha4A (A:)
akytgkctkskneckykndagkdtfikcpkfdnkkctkdnnkctvdtynnavdcd