PDB entry 6ha0

View 6ha0 on RCSB PDB site
Description: Unraveling the role of the secretor antigen in human rotavirus attachment to histo-blood group antigens
Class: viral protein
Keywords: histo-blood group antigen rotavirus, VIRAL PROTEIN
Deposited on 2018-08-06, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Gene: VP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0S0VKY7 (3-161)
      • expression tag (0-2)
      • conflict (98)
    Domains in SCOPe 2.07: d6ha0a1, d6ha0a2
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Gene: VP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0S0VKY7 (3-161)
      • expression tag (2)
      • conflict (98)
    Domains in SCOPe 2.07: d6ha0b1, d6ha0b2
  • Heterogens: NAG, GAL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ha0A (A:)
    gsmldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynv
    fgenkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetp
    rattdssntanlngisitihsefyiiprsqeskcneyinngl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ha0B (B:)
    gsmldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynv
    fgenkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetp
    rattdssntanlngisitihsefyiiprsqeskcneyinngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ha0B (B:)
    mldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfg
    enkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetpra
    ttdssntanlngisitihsefyiiprsqeskcneyinngl