PDB entry 6h9z

View 6h9z on RCSB PDB site
Description: Molecular bases of histo-blood group antigen recognition by the most common human rotavirus
Class: viral protein
Keywords: histo-blood group antigen rotavirus, VIRAL PROTEIN
Deposited on 2018-08-06, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Gene: VP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0S0VKY7 (3-161)
      • expression tag (2)
      • conflict (98)
    Domains in SCOPe 2.07: d6h9za1, d6h9za2
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Gene: VP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h9zb_
  • Heterogens: DTT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h9zA (A:)
    gsmldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynv
    fgenkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetp
    rattdssntanlngisitihsefyiiprsqeskcneyinngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9zA (A:)
    mldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfg
    enkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetpra
    ttdssntanlngisitihsefyiiprsqeskcneyinngl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h9zB (B:)
    gsmldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynv
    fgenkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetp
    rattdssntanlngisitihsefyiiprsqeskcneyinngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9zB (B:)
    ldgpyqpttftppsdywilinsntngvvyestnnsdfwtaviavephvdpvdrqynvfge
    nkqfnvrndsdkwkflemfrgssqndfynrrtltsntrlvgilkyggriwtfhgetprat
    tdssntanlngisitihsefyiiprsqeskcneyinngl