PDB entry 6h9u

View 6h9u on RCSB PDB site
Description: Crystal structure of the BiP NBD and MANF SAP complex
Class: chaperone
Keywords: MANF, BiP, NDI, HSP70, ARMET, CHAPERONE
Deposited on 2018-08-06, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum chaperone BiP
    Species: Cricetulus griseus [TaxId:10029]
    Gene: HSPA5, GRP78, I79_019946
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h9ua1, d6h9ua2
  • Chain 'B':
    Compound: Mesencephalic astrocyte-derived neurotrophic factor
    Species: Mus musculus [TaxId:10090]
    Gene: Manf, Armet
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h9uA (A:)
    gtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqltsn
    pentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeisa
    mvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaai
    aygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfi
    klykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakf
    eelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrg
    inpdeavaygaavqagvlsgdqdtgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h9uA (A:)
    gtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqltsn
    pentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeisa
    mvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaai
    aygldkregeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfi
    klykkktgkdvrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakf
    eelnmdlfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrg
    inpdeavaygaavqagvls
    

  • Chain 'B':
    No sequence available.