PDB entry 6h9j

View 6h9j on RCSB PDB site
Description: factor inhibiting hif (fih) in complex with zinc, nog and trpv3 (229- 255)
Deposited on 2018-08-04, released 2019-08-14
The last revision was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1AN, FIH1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transient receptor potential cation channel subfamily V member 3
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OGA, GOL, SO4, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6h9jA (A:)
gsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvy
palkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvek
lqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligm
egnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyer
fpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplk
ahqkvaimrniekmlgealgnpqevgpllntmikgryn

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >6h9jD (D:)
diaalliaagadvnahakgaff