PDB entry 6h9e

View 6h9e on RCSB PDB site
Description: Structure of glutamate mutase reconstituted with homo-coenzyme B12
Class: isomerase
Keywords: coenzyme b12, co-c-bond, radical reaction, tim-barrel, rossman-fold, isomerase
Deposited on 2018-08-03, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate mutase sigma subunit
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80078 (0-136)
      • conflict (44)
      • conflict (59)
    Domains in SCOPe 2.07: d6h9ea_
  • Chain 'B':
    Compound: Glutamate mutase epsilon subunit
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80077 (0-482)
      • conflict (129)
    Domains in SCOPe 2.07: d6h9eb_
  • Chain 'C':
    Compound: Glutamate mutase sigma subunit
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80078 (0-136)
      • conflict (44)
      • conflict (59)
    Domains in SCOPe 2.07: d6h9ec_
  • Chain 'D':
    Compound: Glutamate mutase epsilon subunit
    Species: Clostridium cochlearium [TaxId:1494]
    Gene: GLME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80077 (0-482)
      • conflict (129)
    Domains in SCOPe 2.07: d6h9ed_
  • Heterogens: FWK, B12, TAR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h9eA (A:)
    mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqenfikaaietkadailv
    sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
    tppevgiadlkkdlnie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h9eB (B:)
    melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
    tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
    llngfpgvnhgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
    yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
    aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
    eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
    mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
    vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
    rpe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h9eC (C:)
    mekktivlgvigsdchavgnkildhaftnagfnvvnigvlspqenfikaaietkadailv
    sslygqgeidckglrqkcdeaglegillyvggnivvgkqhwpdvekrfkdmgydrvyapg
    tppevgiadlkkdlnie
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h9eD (D:)
    melknkkwtdeefhkqreevlqqwptgkevdlqeavdylkkipaeknfaeklvlakkkgi
    tmaqpragvalldehiellrylqdeggadflpstidaytrqnrydecengikesekagrs
    llngfpgvnhgvkgcrkvleavnlplqarhgtpdsrllaeiihaggwtsnegggisynvp
    yaknvtiekslldwqycdrlvgfyeeqgvhinrepfgpltgtlvppsmsnavgitealla
    aeqgvknitvgygecgnmiqdiaalrcleeqtneylkaygyndvfvttvfhqwmggfpqd
    eskafgvivtattiaalagatkvivktpheaigiptkeanaagikatkmalnmlegqrmp
    mskeletemavikaetkcildkmfelgkgdlaigtvkafetgvmdipfgpskynagkmmp
    vrdnlgcvrylefgnvpfteeiknynrerlqerakfegrdvsfqmviddifavgkgrlig
    rpe