PDB entry 6h8s

View 6h8s on RCSB PDB site
Description: crystal structure of the mouse protein tyrosine phosphatase ptpn5 (step) in complex with compound bi-0314
Class: hydrolase
Keywords: protein phosphatase, ptn5, step, allosteric modulator, hydrolase
Deposited on 2018-08-03, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 5
    Species: Mus musculus [TaxId:10090]
    Gene: PTPN5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54830 (Start-300)
      • conflict (187)
      • conflict (298)
    Domains in SCOPe 2.07: d6h8sa_
  • Heterogens: FSZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h8sA (A:)
    ghmasspreesaheyllsasrvlraeelhekaldpfllqaeffeipmnfvdpkeydipgl
    vrknryktilpnphsrvrltspdpedplssyinanyirgysgeekvyiatqgpivstvad
    fwrmvwqertpiivmitnieemnekcteywpeeqvvhdgveitvqkvihtedyrlrlisl
    rrgteertlkhywftswpdqktpdrappllhlvreveeaaqqegphcspiivhcsagigr
    tgcfiatsiccqqlrregvvdilkttcqlrqdrggmiqtceqyqfvhhamslyekqlshq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h8sA (A:)
    saheyllsasrvlraeelhekaldpfllqaeffeipmnfvdpkeydipglvrknryktil
    pnphsrvrltspdpedplssyinanyirgysgeekvyiatqgpivstvadfwrmvwqert
    piivmitnieemnekcteywpeeqvvhdgveitvqkvihtedyrlrlislrrgteertlk
    hywftswpdqktpdrappllhlvreveeaaqqegphcspiivhcsagigrtgcfiatsic
    cqqlrregvvdilkttcqlrqdrggmiqtceqyqfvhhamslyekqlshqs