PDB entry 6h8o

View 6h8o on RCSB PDB site
Description: crystal structure of the master-rep protein nuclease domain from the faba bean necrotic yellows virus
Deposited on 2018-08-02, released 2018-08-22
The last revision was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication-associated protein
    Species: Faba bean necrotic yellows virus [TaxId:59817]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Replication-associated protein
    Species: Faba bean necrotic yellows virus [TaxId:59817]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6h8oA (A:)
arqvicwcftlnnplsplslhdsmkylvyqteqgeagnihfqgyiemkkrtslagmkkli
pgahfekrrgtqgearaysmkedtrlegpweygel

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6h8oB (B:)
arqvicwcftlnnplsplslhdsmkylvyqteqgeagnihfqgyiemkkrtslagmkkli
pgahfekrrgtqgearaysmkedtrlegpweygel