PDB entry 6h8m

View 6h8m on RCSB PDB site
Description: Crystal structure of the third SRCR domain of Murine Neurotrypsin.
Class: hydrolase
Keywords: Neurotrypsin, Extracellular protease, SRCR domain, CRD domain, HYDROLASE
Deposited on 2018-08-02, released 2019-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotrypsin
    Species: Mus musculus [TaxId:10090]
    Gene: Prss12, Bssp3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h8ma_
  • Chain 'B':
    Compound: Neurotrypsin
    Species: Mus musculus [TaxId:10090]
    Gene: Prss12, Bssp3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6h8mb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6h8mA (A:)
    gsgfpirlvdgenkkegrvevfvngqwgticddgwtdkhaavicrqlgykgparartmay
    fgegkgpihmdnvkctgnekaladcvkqdigrhncrhsedagvicdylekkass
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h8mA (A:)
    gfpirlvdgenkkegrvevfvngqwgticddgwtdkhaavicrqlgykgparartmayfg
    egkgpihmdnvkctgnekaladcvkqdigrhncrhsedagvicdyle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6h8mB (B:)
    gsgfpirlvdgenkkegrvevfvngqwgticddgwtdkhaavicrqlgykgparartmay
    fgegkgpihmdnvkctgnekaladcvkqdigrhncrhsedagvicdylekkass
    

    Sequence, based on observed residues (ATOM records): (download)
    >6h8mB (B:)
    gfpirlvdgenkkegrvevfvngqwgticddgwtdkhaavicrqlgykgparartmayfg
    egkgpihmdnvkctgnekaladcvkqdigrhncrhsedagvicdyle