PDB entry 6h8j

View 6h8j on RCSB PDB site
Description: 1.45 A resolution of Sporosarcina pasteurii urease inhibited in the presence of NBPTO
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-08-02, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h8ja_
  • Chain 'B':
    Compound: urease subunit beta
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6h8jb_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, SO4, NI, 2PA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h8jA (A:)
    mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6h8jB (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    No sequence available.