PDB entry 6h8j

View 6h8j on RCSB PDB site
Description: 1.45 A resolution of Sporosarcina pasteurii urease inhibited in the presence of NBPTO
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-08-02, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Urease subunit gamma
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YGY5 (1-99)
  Domains in SCOPe 2.08: d6h8ja_
• Chain 'B':
  Compound: urease subunit beta
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41021 (0-121)
  Domains in SCOPe 2.08: d6h8jb_
• Chain 'C':
  Compound: urease subunit alpha
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0H3YL32 (0-569)
• Heterogens: EDO, SO4, NI, 2PA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6h8jA (A:)
  mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
  khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6h8jB (B:)
  nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
  rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
  ve
  

  
  
• Chain 'C':
  No sequence available.